<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1602 1602-30528 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   L100I, Y181I A98G, V108I E44D, K122E, I135T, I202IV, E203K, Q207D, H208Y, R211K, K223Q, L228H  
>1602-30528| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGIKKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIIQYVDDLYVGSDLEIGQHRTKVKELRDYLWKWGFYTP
DKKHQQEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, L76V, I84V, L90M L10F, V11I, G73S I15V, K20I, E34Q, E35D, M36I, N37T, K55KR, R57K, I62V, L63P, A71V  
>1602-30528| codons 4-99
TLWQRPFITIKVGGQLIEALLDTGADDTVLQDITLPGRWKPKIIGGIGGFLRVKQYDQVP
IEICGHKVISTVVVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006