<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1260 1260-30318 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A L23I, Q58E L10IV, I15V, G16GA, L63A, A71V, I93L  
>1260-30318| codons 4-99
TLWQRPVVTIKVAGQLKEAILDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVREYDQIA
IEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151KM T215TI, K219Q K101E, G190A   T69S, V106I, D121HY, K122E, D177E, V179VA, F214L, V245M  
>1260-30318| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSSRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSITVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPEIAIYQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGLITP
DQKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006