<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2045 2045-40505 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, I84V   L10I, T12S, I13V, K20M, M36I, L63P, I64V  
>2045-40505| codons 1-99
PQITLWQRPIVSVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
QIPVEICGHKAIGTVLVGPTPFNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219R Y188L   V35L, T39A, K43E, V60I, V106I, V118I, K122E, I135M, S162N, T200A, R211K, L228H, V245K, A272P, T286A, E297K, K311R, D324E, R356K, M357R, G359S, D364E, A371V, K390R S191SF
>2045-40505| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEEEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIVI
YQYVDDLLVGFDLEIGQHRAKIEELRQHLWKWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILREPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKRRSA
HTNEVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006