<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2045 2045-30702 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, I84V   L10I, T12S, I13V, K20M, M36I, L63P, I64V  
>2045-30702| codons 4-99
TLWQRPIVSVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYDQIP
VEICGHKAIGTVLVGPTPFNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y K219R Y188L   T39A, K43E, V60I, K102KM, V106VI, V118I, K122E, S162N, T200A, R211K, L228LH, K238KR, V245EK  
>2045-30702| codons 38-247
CAELEEEGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKMKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DRKHQKEPPFHWMGYELHPDRWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006