<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1258 1258-30529 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, L24I, L33F K20T, E35D, M36I, R57RK, I62V, L63P, H69Q, A71V, I93L  
>1258-30529| codons 4-99
TLWQRPFVTIKIGGQLTEALIDTGADDTVFEDINLPGRWKPKIIGGIGGFVKVKQYDQVP
IEICGQKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R K103N   K43Q, E44ED, V60I, K82KR, V118I, K122E, D123DN, I135IV, R211K I244T
>1258-30529| codons 38-247
CTELEQDGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNRRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPTVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006