<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1253 1253-30318 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215FY   Y188L   K43E, V118VI, D123E, I135L, D177E, V179I, T200A, H208Y, R211K, L228H  
>1253-30318| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYMDDLLVGSDLEIGQHRAKIEELRQYLLKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46I, I47V, I54L, I84V, L90M L10F, L33F, F53L, Q58E I13IV, G16E, L19LI, K20R, E34EQ, E35D, M36I, N37S, I62V, L63H, A71V, I72V  
>1253-30318| codons 4-99
TLWQRPFVTVKIEGQIREALLDTGADDTIFQDISLPGRWKPKIVGGIGGLLKVREYDQVH
IEICGHKVVGTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006