<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1600 1600-30702 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V T215C, K219E K103KN, Y181C   V60VI, V90VI, K102Q, K122KE, D123E, S162C, V179I, T200TA, I202V, H221HY, L228H D113DN
>1600-30702| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKQNKSVTVLDVGNAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIIICQYVDDLYVGSDLEIGQHRAKVEELRQHLLRWGFCTP
DEKYQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46IV, I47V, I54M L10F, L33F L63LP, K70KE, A71V, V77VI, I85IV  
>1600-30702| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTIFEEMNLPGRWKPKVVGGIGGFMKVRQYDQIP
IEICGHEVIGTVLIGPTPVNIVGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006