<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1818 1818-30728 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75M K103N   T39A, K43EQ, E44D, K102R, V118I, K122E, E138A, R211K  
>1818-30728| codons 38-247
CAELEQDGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82VA, N88NS, L90M L33F, Q58QE, G73S L10V, I13V, K14R, K20R, E35D, M36I, N37DE, K55R, R57K, I62V, L63P, A71AV, Q92K  
>1818-30728| codons 4-99
TLWQRPVVTVRIGGQLREALLDTGADDTVFEDIELPGRWKPKLIGGIGGFLRVKEYDQVP
IEICGHKVISTVLVGPTPANIIGRSLMTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006