<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1662 1662-30414 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V, L90M   L10I, T12P, L63P, A71V, I85V, Q92K  
>1662-30414| codons 4-99
TLWQRPIVPIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQIP
IEICGHKVIGTVLVGPTPTNVVGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219E K103N   V60I, T69S, K122E, I135IT, Q207E, L228H, V245R  
>1662-30414| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSSRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIRLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006