<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1661 1661-30404 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M G73T L10I, T12DE, I15V, K20I, M36I, K45R, L63P, I64V, C67F, A71V, V75I, I93L  
>1661-30404| codons 4-99
TLWQRPIVEIKVGGQLIEALLDTGADDTVLEEINLPGRWKPRMIGGIGGFVKVRQYDQIP
VEIFGHKVITTILVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70KR, L210W, T215Y D67H, K219Q K103N   T39A, K43E, V60I, S68N, T69N, V118I, K122E, I135T, T139M, S162Y, I202V, R211K, L228H T84TA
>1661-30404| codons 38-247
CAELEEEGKISKIGPENPYNTPIFAIKKKHNNRWRKLVDFRELNKRAQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006