<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1252 1252-30324 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V L24I, L33F, Q58E L10Y, T12P, I13V, G16A, L19P, K20T, M36I, N37D, D60N, L63P, A71V, T91S  
>1252-30324| codons 4-99
TLWQRPYVPVKIAGQPTEALIDTGADDTVFEEIDLPGRWKPKIIGGIGGFVKVREYNQIP
IEICGHKVIGTVLVGPTPTNVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74I, M184V T215D K103N V108I K122E, D123E, I135M, Q174K, D177E, T200I, I202V, R211RK  
>1252-30324| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDEEFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPEIVIYQYVDDLYVGSDLEIGQHRIKVEELRQHLLKWGFDTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006