<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1593 1593-30717 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73T L19Q, N37NS, K55R, D60E, L63P, I64V, I66V, V77I, P79A  
>1593-30717| codons 4-99
TLWQRPFVTIKIGGQQKEALLDTGADDTVLEEMSLPGRWKPKIIGGIGGFVRVRQYEQIP
VEVCGHKAITTVLIGATPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q G190GA   T39TA, T69E, V118I, K122E, I135T, H208Y, R211K, F214L, V245M  
>1593-30717| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVASDLEIGQHRTKIEELRQYLLKWGLFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006