<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1592 1592-30701 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V, L90M V11I L10I, T12P, I13V, I15V, G16E, K20I, Q61K, I62V, L63Q, I64V, A71V, V77I  
>1592-30701| codons 4-99
TLWQRPIIPVKVEGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDKVQ
VEICGHKVIGTVVIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69DY, L210W, T215Y   K103KT   T39TA, K43Q, V60I, K102KR, D123E, S134SG, I135T, D177E, I178L, G196E, T200A, H208Y, R211K, V245E  
>1592-30701| codons 38-247
CAELEQEGKISKIGPENPYNTPIFAIKKKNSYKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRTKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPGTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPELVIYQYMDDLYVGSDLEIEQHRAKIEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006