<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1591 1591-30618 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215F V75M, K219E K103S, G190GA   V60I, K122E, I135IMV, P170PL, R172RK, D177E, R211K  
>1591-30618| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILELFKKQNPEIVIYQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFFTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54T, V82A, L90M K43KT, G73GS L10I, I15V, G16A, K20L, N37D, L63P, A71L, T74S, V77I, I85V, I93L  
>1591-30618| codons 4-99
TLWQRPIVTIKVAGQLLEALLDTGADDTVLEEMDLPGRWTPKIIGGIGGFTKVRQYDQIP
IEICGHKLISSVLIGPTPANIVGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006