<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1897 1897-30707 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54A, V82T, L90M   L10I, I15V, K20R, E35D, M36I, N37D, K55R, I62V, L63P, A71I, I93L, C95F  
>1897-30707| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGRWKPKIIGGVGGFARVRQYDQVP
IEICGHKIIGTVLVGPTPTNIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219Q     E44ED, I94L, V118I, K122E, D123E, D218E, V245K K201KE, F214FS
>1897-30707| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGLPHP
AGLKKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTEIEELRQHLWRWGSYTP
EQKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006