<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1893 1893-30611 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, V82VCFG, I84V, L90M L10F, Q58E, G73GAST L19I, L63P, H69R, K70R, I93M, C95F  
>1893-30611| codons 4-99
TLWQRPFVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVREYDQIP
IEICGRRAITTVLVGPTPGNVIGRNLMTQMGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, L210LW, T215Y K219E K103N, Y181C, G190A   T39A, E44D, V118VI, K122KE, K173T, H208HY, R211RK, D218E, L228H  
>1893-30611| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTQNPDIVICQYVDDLYVASDLEIGQHRTKIEELRQYLWKWGFYTP
EEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006