<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1789 1789-30512 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54M, V82A, I84V   L10I, T12E, E35D, M36MI, I62V, L63P, A71V, T74S, I93L  
>1789-30512| codons 4-99
TLWQRPIVEIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIVGIGGFMKVRQYDQVP
IEICGHKVIGSVLVGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q     T39A, V118I, D123E, I135T, K166R, E169D, I202IV, Q207E, F214L, L228LH  
>1789-30512| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELREHLLRWGLFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006