<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1787 1787-30507 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219Q   A98G S68G, T69E, V90VI, V118I, K122E, I135T, E204Q, Q207E, R211K, F214L  
>1787-30507| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGGERWRKLVDFRELNKRTQDFWEIQLGIPHP
GGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEQLREHLLKWGLFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54M, V82S, L90M L33F L10I, I13V, K20T, E34EQ, E35D, M36V, N37DE, I62V, L63P, I64M, H69Q, A71I, I72V, V77I, I93L  
>1787-30507| codons 4-99
TLWQRPIVTVKIGGQLTEALLDTGADDTVFQDVELPGRWKPKMIVGIGGFMKVRQYDQVP
MEICGQKIVGTVLIGPTPSNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006