<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1724 1724-30421 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, I84V, L90M L10F, V11I, L33F, Q58E, G73C I15IV, K20IV, E34Q, R41K, Q61H, L63R, K70T, A71V, V77I, I85IV  
>1724-30421| codons 4-99
TLWQRPFITIKVGGQLVEALLDTGADDTIFQEMNLPGKWKPKIVGGIGGFMKVREYDHIR
IEICGHTVICTVLIGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, T215F K219N K103N   K49E, D123E, I142K, K166R, Q174N, D177E, I178IV, Q197E, I202V, E203K, Q207A, H208Y, R211K, K223E  
>1724-30421| codons 38-247
CTELEKEGKISEIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGKRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKNNPEVVIYQYVDDLYVGSDLEIGEHRTKVKELRAYLLKWGFFTP
DNKHQEEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006