<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1723 1723-30418 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M V11I, L89V L10I, I13V, K20I, M36I, I62V, L63P, C67F, H69Q, A71V, T74E, T91S, Q92K, I93L  
>1723-30418| codons 4-99
TLWQRPIITVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYDQVP
IEIFGQKVIGEVLVGPTPVNVIGRNVMSKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   Y188L   K43E, V60VI, V118I, K122E, S162C, E169D, G196E, Q207E K102Y
>1723-30418| codons 38-247
CTELEEEGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKYKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKQNPDIVIYQYVDDLLVGSDLEIEQHRTKIEELREHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006