<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1721 1721-30410 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MI, I54L, I84V, L90M L10F, L33F, G73T E34Q, K55KR, D60DE, L63P, I64V, I66F  
>1721-30410| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTIFQEMNLPGRWKPKIIGGIGGFLRVRQYEQIP
VEFCGHKAITTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210LW, T215Y   Y188L A98G K43E, E44D, K102M, V106I, V118I, K122E, I178IM, V189VI, T200E, E203K, H208Y, R211K, K223Q, L228H, V245T  
>1721-30410| codons 38-246
CTELEEDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLKMKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLLIGSDLEIGQHREKIKELRQYLWKWGFYTP
DKKHQQEPPFHWMGYELHPDKWTVQPITL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006