<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1654 1654-30407 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A, L90M F53L, N88D L10IV, L19I, K20R, E35D, M36I, N37D, R41K, K55KR, R57K, D60E, I62V, L63S, A71V, I93L, C95F  
>1654-30407| codons 4-99
TLWQRPVVTIKIGGQIREALLDTGADDTVLEDIDLPGKWKPKMIMGIGGLVRVKQYEQVS
IEICGHKVIGTVLVGPTPANIIGRDLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Y115F, Q151M, M184V V75I, F77L, F116Y, T215V, K219E Y181C V108VI V60VI, T69N, V118I, I142T, T165I, V179I, T200A, Q207A, R211K, F214L, L228H  
>1654-30407| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAFYSIPLDKDFRKYTAFTIPSINNETPGTRYQYNVLPMGWKGSP
AIFQSSMIKILEPFRKQNPDIIICQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGLVTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006