<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1649 1649-30319 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219N Y181C, G190A   E40F, K43Q, K122E, D123T, I142V, K166R, V179I, T200A, H208Y, R211K  
>1649-30319| codons 38-247
CTFLEQEGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDETFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIIICQYVDDLYVASDLEIGQHRAKIEELRQYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, V82T, L90M V11I, G73S, L89V L10I, L63P, A71V, V77I, I85V  
>1649-30319| codons 4-99
TLWQRPIITIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKMVGGIGGFMKVRQYDQIP
IEICGHKVISTVLIGPTPTNIVGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006