<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1963 CA7524 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 DDI 35
3 D4T 31
4 3TC+AZT+IDV 113
5 D4T+DDI+EFV+NFV 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A L89V L10I, I13V, L19I, N37D, G51A, D60E, L63P, A71V, I93IL  
>CA7524| codons 1-99
PQITLWQRPIVTVKIGGQIKEALLDTGADDTVLEEMDLPGRWKPKIIGGIAGFIKVRQYE
QIPIEICGHKVIGTVLVGPTPANIIGRNVLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215V, K219Q K103N   V35L, T69N, D123DE, K166T, V179I, G196E, V245EK, K277R, L279X, T290TA, I293V, P294T, E297K K263KQ, N265NT, R284RT
>CA7523| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTTILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGQLTWASQIYAGIKVRQXCKLLTGTKALAEVVTLTKEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009