<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1241 1241-30227 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82A, I84V, L90M L33F, F53L L10I, I13V, I15V, K20R, M36L, N37D, I62V, L63P, I66F, A71V  
>1241-30227| codons 4-99
TLWQRPIVTVKVGGQLREALLDTGADDTIFEELDLPGRWKPKIVGGIGGLLKVRQYDQVP
IEFCGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, L210W, T215Y V75T, K219Q Y181C, G190A V108I, V179D K101Q, K122E, D123E, Q197K, D218E, L228H  
>1241-30227| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKITDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTILDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIDICQYVDDLYVASDLEIGKHRTKIEELRQHLWRWGFYTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006