<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1963 CA7523 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 DDI 35
3 D4T 31
4 3TC+AZT+IDV 113
5 D4T+DDI+EFV+NFV 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215V, K219Q K103N   V35L, T69N, D123DE, K166T, V179I, G196E, V245EK, K277R, L279X, T290TA, I293V, P294T, E297K K263KQ, N265NT, R284RT
>CA7523| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTTILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGQLTWASQIYAGIKVRQXCKLLTGTKALAEVVTLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A L89V L10I, I13V, L19I, N37D, G51A, D60E, L63P, A71V, I93IL  
>CA7524| codons 1-99
PQITLWQRPIVTVKIGGQIKEALLDTGADDTVLEEMDLPGRWKPKIIGGIAGFIKVRQYE
QIPIEICGHKVIGTVLVGPTPANIIGRNVLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009