<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2147 2147-30702 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L24I L10I, T12P, G16GA, K20R, M36I, D60E, I62V, L63P, A71V, I72T, I93L  
>2147-30702| codons 4-99
TLWQRPIVPIKIAGQLREALIDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYEQVP
IEICGHKVTGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   Y188L   T39A, E44D, K49R, S68G, V118I, K122E, I135T, V179VI, T200K, R211N, D218E, D237DE  
>2147-30702| codons 38-247
CAELEKDGKISRIGPENPYNTPVFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLLVGSDLEIGQHRKKIEELRQHLWNWGFYTP
EKKHQKEPPFLWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006