<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2014 2014-30619 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A, L90M   L10V, T12P, I15V, G16A, L19P, K20M, N37D, R41RK, I62V, L63P, A71V, I72T, L89I, Q92K  
>2014-30619| codons 4-99
TLWQRPVVPIKVAGQPMEALLDTGADDTVLEEMDLPGKWKPKLIGGIGGFVKVRQYDQVP
IEICGHKVTGTVVVGPTPANIIGRNIMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215I, K219E K103N   K43KN, T69TN, V118I, I135T, E169D, F214L, V245M  
>2014-30619| codons 38-247
CTEMENEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLITP
DEKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006