<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1768 1768-30522 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M V75M, F77L, T215D K103N V108I S68G, A98S, K122E, I135V, E138Q, A158S, S162A, R172K, G196E, H221Y P52T
>1768-30522| codons 38-247
CTEMEKEGKISKIGTENPYNTPVFAIKRKDGTRWRKLMDLRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSVNNQTPGIRYQYNVLPMGWKGSP
SIFQASMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFDTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54L, V82C, L90M L10F, L33F, K43T, N88D I13V, I15V, K20T, E35D, M36I, N37D, R41RK, R57K, I62V, L63P, K70KN, A71V, I85IV, L89LM, Q92QK, T96S  
>1768-30522| codons 4-99
TLWQRPFVTVKVGGQLTEALLDTGADNTVFEDIDLPGKWTPKMIGGIGGFLKVKQYDQVP
IEICGHNVIGTVLVGPTPCNIVGRDMMTKIGCSLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006