<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1766 1766-30521 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48A, I54V, V82S L24I, K43T L10I, K20R, E35D, M36I, K55R, R57K, I62V, L63P, I66IF, A71V  
>1766-30521| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVLEDINLPGRWTPKLIAGIGGFVRVKQYDQVP
IEFCGHKVIGTVLVGPTPSNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, V75I, F116Y K103KN, Y181YC, G190GA   S68K, S162A, Q174QR, I202V  
>1766-30521| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDKTKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQASMTKILEPFRKRNPDIVICQYMDDLYVASDLEIGQHRTKVEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006