<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1574 1574-30325 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L33F, G73S L10I, K20KR, M36I, I62V, L63P, A71V, I72L  
>1574-30325| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFEEINLPGRWKPKMIGGIGGFVKVRQYDQVP
IEICGHKVLSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215F K219Q     T39A, T69N, K166Q, E169D, T200A, I202V, H208Y, D218E, L228LH  
>1574-30325| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTQILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKVEELRQYLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006