<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1571 1571-30820 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215Y V75T, K219KE Y181C, G190A   K102E, V118I, K122E, Q174R, V179I, Q197L, E204D, R211K, F214L, D218E, L228H, A272P, I326V, G333E, Q334C, G359S, T386I, K390R, E399D  
>1571-30820| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKITDFRELNKRTQDFWEVQLGIPHPAGLKEKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIII
CQYVDDLYVASDLEIGLHRTKIEDLRQHLLKWGLYTPEEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQECGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82AT, I84V L33F L10I, K20R, E35D, M36I, N37ND, R57K, D60E, L63P, A71V, I93L  
>1571-30820| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVFEDIDLPGRWKPKMIGGIGGFVKVKQYE
QIPIEICGHKVIGTVLVGPTPTNVIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006