<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1569 1569-30307 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, V82T, L90M L10F, L33F I13V, K20R, M36I, K55R, I62V, L63P, I64L, A71V, Q92QH, I93L, C95F  
>1569-30307| codons 4-99
TLWQRPFVTVKIGGQLREALLDTGADDTVFEEINLPGRWKPKIIGGVGGFIRVRQYDQVP
LEICGHKVIGTVLVGPTPTNIIGRNLMTHLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DN, K70R, Q151M V75I, F77L, F116Y, K219Q K103N   S105SA, K122P, D123E, I135L, D177E, T200A, L228H V111IM
>1569-30307| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKNKAVTVLDMGDAYYSVPLDPEFRKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006