<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1568 1568-30306 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82F   L10I, P39S, R57K, I62V, L63P, I64V, I72V, V77I, I85V  
>1568-30306| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLSGRWKPKIVGGIGGFVKVKQYDQVP
VEICGHKAVGTVLIGPTPFNIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y D67G, K219N G190Q   E44D, V60I, S68G, K102KR, V118I, K122E, I135V, T200TA, Q207E, R211K, L228LH, V245Q  
>1568-30306| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKRKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVQSDLEIGQHRAKIEELREHLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006