<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1565 1565-30225 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74V, T215F D67G, K219E L100I, K103N   S68G, A98S, K102R, K122E, T200I, R211T, L228H, V245M  
>1565-30225| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKGGTRWRKVVDFRELNKRTQDFWEVQLGIPHP
SGIKRNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRIKIEELRQHLLTWGFFTP
DEKHQKEPPFHWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, L76V, V82A, L90M F53L L10I, I15V, K20R, M36I, I62V, L63AP, A71V, I72V, I93L  
>1565-30225| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEEINLPGRWKPKMIMGIGGLVKVRQYDQVP
IEICGHKVVGTVVVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006