<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1564 1564-30616 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F D67G, K219Q L100I, K103N Y181F T69H, K102Q, D121DH, K122E, D192DH, T200E, E203K, Q207E, D218E, K223Q, L228HR  
>1564-30616| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGSHRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKQNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIFQYMDDLYVGSHLEIGQHREKIKELREHLLRWGFFTP
EQKHQQEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, L33F, G73T L19LI, L63P, I66V, H69R, P79H, I93L, C95F  
>1564-30616| codons 4-99
TLWQRPFVTIKIGGQIKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYDQIP
IEVCGRKAITTVLVGHTPVNVIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006