<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1562 1562-30610 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, L210W T215E, K219Q K103KN, Y188L   K64H, T69N, K102MR, I135T, D177DG, V179VI, G196E, I202IV, R211RK, D218E, L228H  
>1562-30610| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGIIIYQYVDDLLVGSDLEIEQHRTKVEELRQHLWKWGFETP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L10F, L24I, L33F, K43T T12Q, I13V, L19I, M36MI, K55KR, I62V, L63P, C67E, L89M, T91V  
>1562-30610| codons 4-99
TLWQRPFVQVKIGGQIKEALIDTGADDTVFEEINLPGRWTPKIIGGIGGFVRVRQYDQVP
IEIEGHKAIGTVVVGPTPANIIGRNMLVQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006