<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1554 1554-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54V, V82A, L90M L33F, F53L, L89V L10I, I13V, K20R, M36I, L63P, A71I  
>1554-30625| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTIFEEINLPGRWKPKMIGGIGGLVKVRQYDQIP
IEICGHKIIGTVLVGPTPANIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q L100I, K103N   K66KR, K122E, A158S, K166R, D177A, G196A, T200I, D218E, L228R  
>1554-30625| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKRNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQSSMTRILEPFRKQNPAIVIYQYMDDLYVGSDLEIAQHRIKIEELRQHLLRWGFFTP
EQKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006