<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1555 1555-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, L90M L10F K20I, E35N, M36I, N37D, K55R, R57RK, I62V, L63P, I66F, C67Y, A71T, I72L  
>1555-30625| codons 4-99
TLWQRPFVTIKIGGQLIEALLDTGADDTILENIDLPGRWKPKIVGGIGGFLRVKQYDQVP
IEFYGHKTLGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, K70Q, V75I, F116Y     V60I, S68G, S162W, R211K, F214L  
>1555-30625| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFVIKKKDGTQWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQWSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006