<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1553 1553-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M L23LI, L33F, G73S L10I, T12P, I15V, L19S, E35D, M36L, R41K, I62V, L63P, I93L  
>1553-30625| codons 4-99
TLWQRPIVPIKVGGQSKEAILDTGADDTVFEDLNLPGKWKPKIIGGIGGFVKVRQYDQVP
IEICGHKAISTVLVGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     K64H, T69N, V118I, G196E, E203K, Q207E, R211RK, F214L, L228H, V245M  
>1553-30625| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIKELREHLLKWGLFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006