<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1548 1548-30811 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V   L10I, I15V, E35D, M36I, N37Q, R41K, L63T, I93L  
>1548-30811| codons 4-98
TLWQRPIVTIKVGGQLKEALLDTGADDTVLEDIQLPGKWKPKIIGGIGGFVKVRQYDQIT
IEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184MV K219Q K103N   K122P, I142V, S162A, I178L, T200A, E204K, Q207E, R211K, F214L  
>1548-30811| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSP
AIFQASMTKILEPFRKQNPDLVIYQYVDDLYVGSDLEIGQHRAKIEKLREHLLKWGLTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006