<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1549 1549-30811 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       K43KE, S68G, K122E, I135T, Q174K, V179I, G196E, E203D, Q207D, R211K  
>1549-30811| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPDIIIYQYMDDLYVGSDLEIEQHRTKIDELRDHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33LF, K43T L10IV, K20KR, E35D, M36I, N37S, K55R, D60E, I62V, L63P, I64IV, I72V, Q92K  
>1549-30811| codons 4-99
TLWQRPVVTIKIGGQLREALIDTGADDTVFEDISLPGRWTPKLIGGIGGFVRVRQYEQVP
VEICGHKAVGTVLVGPTPANIIGRNLLTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006