<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1547 1547-30805 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, V82A   M36I, D60DE, L63P, A71AV  
>1547-30805| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTILEEINLPGRWKPKMIGGIGGFIKVRQYEQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, T215FI       K43RS, K49KR, I50IV, R83K, D121HY, K122E, K166KE, E169D, I178L, G196R, F214L  
>1547-30805| codons 38-247
CTEMESEGKISRVGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTEILDPFRKQNPDLVIYQYMDDLYVGSDLEIRQHRTKIEELRQHLLRWGLITP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006