<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1856 1856-30506 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q Y188L V179D T39E, K49KR, T69TN, A98S, K103R, K173T, E203K, Q207A, H208Y, R211K, K223Q, V245T  
>1856-30506| codons 38-247
CEEMEKEGKISRIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTQNPDIDIYQYMDDLLVGSDLEIGQHRTKIKELRAYLLKWGFFTP
DQKHQQEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L33LF, F53L, G73S L10I, R41K, D60E, L63P, H69R, A71V, I72L, V77I  
>1856-30506| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGKWKPKIIGGIGGLVKVRQYEQIP
IEICGRKVLSTVLIGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006