<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1546 1546-30424 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48GA, I54V, V82A L24I, L33F, K43T, T74P L10I, I13V, K20R, E35D, M36I, N37T, K55R, R57K, I62V, L63P, A71IV, I93L  
>1546-30424| codons 4-99
TLWQRPIVTVKIGGQLREALIDTGADDTVFEDITLPGRWTPKLIAGIGGFVRVKQYDQVP
IEICGHKVIGPVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y D67G, V75A, K219N K103N F227FL T39A, K43KQ, E44D, S68G, V118VI, D123E, T200A, E203K, H208HY, R211KT, K223E  
>1546-30424| codons 38-247
CAELEQDGKISKIGPENPYNTPVFAIKKKGGTKWRKVADFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIKELRQYLWTWGFYTP
DNKHQEEPPLLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006