<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1543 1543-30411 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V V75I, K219Q Y181YC, G190A   K49R, V60I, K122E, S162D, E169A, V179I, T200A, I202IV, Q207E, F214FL  
>1543-30411| codons 38-247
CTEMEKEGKISRIGPENPYNTPIFAIKKKNSDRWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILAPFRKQNPDIIICQYVDDLYVASDLEIGQHRAKVEELREHLLRWGLTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M L10F, G73S I15V, R41K, I62V, L63P, I64IV, A71T, V77I, I93L  
>1543-30411| codons 4-99
TLWQRPFVTIKVGGQLKEALLDTGADDTILEEMNLPGKWKPKIVGGIGGFMKVRQYDQVP
VEICGHKTISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006