<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1542 1542-30409 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82A, L90M L33F, G73S L10I, I13V, I15IV, K20R, L24S, E35D, M36I, N37ND, R41N, R57K, I62V, L63P, I93L  
>1542-30409| codons 4-99
TLWQRPIVTVKVGGQLREALSDTGADDTVFEDIDLPGNWKPKLIGGIGGFVKVKQYDQVP
IEICGHKAISTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R K103N   E44D, K49R, V60VI, R83K, V118I, D123N, E169D, D177E, T200A  
>1542-30409| codons 38-247
CTELEKDGKISRIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006