<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2389 2389-30818 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L, I54V, V82A L10F, L33F, N88D I13V, K20T, I62V, L63P, A71V, V77I  
>2389-30818| codons 4-99
TLWQRPFVTVKIGGQLTEALLDTGADNTVFEEMNLPGRWKPKLIGGIGGFVKVRQYDQVP
IEICGHKVIGTVLIGPTPANIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N Y181C A98G E44D, V111VI, V118I, D123E, S163C, D177E, H208Y, R211K, D218E W212LM
>2389-30818| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDIGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSCMTKILEPFRKQNPEIVICQYVDDLYVGSDLEIGQHRTKIEELRQYLWKMGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006