<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2067 2067-30714 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, K14R, K20I, E35D, M36I, N37DE, L63P, A71V  
>2067-30714| codons 4-99
TLWQRPLVTVRIGGQLIEALLDTGADNTVLEDIELPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       T69TN, W88C, D123E, D177E  
>2067-30714| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006