<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2070 2070-30609 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MIL, I50V   L10V, I15V, L19I, K43R, L63P, A71AV, Q92QK  
>2070-30609| codons 4-99
TLWQRPVVTIKVGGQIKEALLDTGADDTVLEEMNLPGRWRPKLIGGVGGFIKVRQYDQIP
IEICGHKVIGTVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   G190A V179E K43E, E44A, K49R, V60I, S68G, K103R, K122E, I135T, S162C, V189A, I202M, E203D, H221Y, L228R, V245E  
>2070-30609| codons 38-247
CTELEEAGKISRIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIEIYQYMDDLYAASDLEIGQHRTKMDELRQHLWRWGFYTP
DKKYQKEPPFRWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006